• Home
  • About us
  • Log-In
  • Join Us
  • Sitemap
  • Recruit
제품/실험 Q&A
자주묻는질문
자유게시판
실험기법
자료신청
논문자료
클레임 접수
기기 A/S 접수
클레임 진행조회
 제품안내  면역학   Cell Biology  Oxidative & Cellular Stress

Nitric Oxide Synthase (NOS) Inhibitors

Oxidative stress는 체내에서 일어나는 산화작용으로, 대사과정중에 생기는 유해물질인 활성산소가 증가하거나 항산화물질이 저하되면 촉진되며, 이는 동맥경화, 심장질환, 뇌졸중, 당뇨, 비만, 암등 각종 질병을 유발합니다.

항산화기작에 관여하는 Nitric Oxide (NO)연구에 필요한 Nitric Oxide Synthase의 작용을 억제하는 Inhibitor를 소개합니다.
Merck Millipore
제품 문의하기
인쇄하기
    종류 및 특징
  • DNA Methyltransferase Inhibitor
Cat. No. Name Product Biological Activity
100050 1400W N-(3-Aminomethyl)benzylacetamidine, 2HCl inhibitor of inducible nitric oxide synthase (iNOS)
219482 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo.
H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH
219483 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable
H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Arg-Tyr-OH
215921 Chlorpromazine, Hydrochloride 2-Chloro-10-[3′-(dimethylamino)propyl]phenothiazine, HCl Inhibits calmodulin-dependent stimulation of cyclic nucleotide phosphodiesterase
265005 Dexamethasone 9α-Fluoro-16α-methylprednisolone Inhibits the phosphorylation of retinoblastoma (Rb) protein
300260 Diphenyleneiodonium Chloride DPI inhibits iNOS in macrophages
341180 2-Ethyl-2-thiopseudourea, Hydrobromide S-Ethylisothiourea, HBr, S-Ethyl-ITU, HBr inhibitor of the inducible, endothelial, and neuronal human nitric oxide synthase isozymes.
400600 L-N5-(1-Iminoethyl)ornithine, Dihydrochloride L-NIO, 2HCl inhibitor of endothelial nitric oxide synthase (eNOS)
482100 L-NIL, Dihydrochloride L-N6-(1-Iminoethyl)lysine, DiHCl inhibitor of nitric oxide synthase
444600 MEG, Hydrochloride Mercaptoethylguanidine, HCl inhibitor of inducible nitric oxide synthase (iNOS) and a peroxynitrite scavenger
444300 Melatonin N-Acetyl-5-methoxytryptamine, 5-Methoxy-N-acetyltryptamine Inhibits rat cerebellar nitric oxide synthase (NOS).
311204 NG,NG′-Dimethyl-L-arginine, Dihydrochloride SDMA, 2HCl Endogenous inhibitor of nitric oxide synthesis in vitro and in vivo.
311203 NG,NG-Dimethyl-L-arginine, Dihydrochloride ADMA, 2HCl reversible inhibitor of nitric oxide synthase
483120 NG-Nitro-L-arginine L-NNA, NG-NO2-L-Arg potent and reversible inhibitor of bNOS and eNOS
483125 NG-Nitro-L-arginine Methyl Ester, Hydrochloride Nω-NO2-L-Arg-OMe, NG-NO2-L-Arg-OMe, L-NAME, HCl reversible inhibitor of eNOS
475892 NG-Monomethyl-D-arginine, Monoacetate Salt D-NMMA, Nω-Me-D-Arg, NG-Me-D-Arg, AcOH Negative control for NG-Monomethyl-L-arginine
475886 NG-Monomethyl-L-arginine, Monoacetate Salt Nω-Me-L-Arg, NG-Me-L-Arg, AcOH, L-NMMA as a competitive inhibitor of all three isoforms of nitric oxide synthase(eNOS, iNOS, nNOS)
484235 p-Nitroblue Tetrazolium Chloride NBT, Nitro BT inhibits nitric oxide synthase
483400 7-Nitroindazole 7-Ni reversible and competitive inhibitor of nitric oxide synthase (NOS)
490070 nNOS Inhibitor I (4S)-N-(4-Amino-5[aminoethyl]aminopentyl)-N′-nitroguanidine, TFA inhibitor of neuronal nitric oxide synthase (nNOS)
529570 PPM-18 2-Benzoylamino-1,4-naphthoquinone inhibits the expression of inducible nitric oxide synthase (iNOS)
548000 1-Pyrrolidinecarbodithioic Acid, Ammonium Salt APDC, Ammonium Pyrrolidinedithiocarbamate, PDTC, NH4 Inhibits the induction of nitric oxide synthase activity in rat alveolar macrophages.
472804 S-Methyl-L-thiocitrulline, Dihydrochloride Nδ-(S-Methyl)isothioureido-L-ornithine inhibitor of nitric oxide synthase
466220 S-Methylisothiourea, Sulfate 2-Methyl-2-thiopseudourea, Sulfate, SMT inhibitor of inducible nitric oxide synthase (iNOS)
567300 SKF-525A, Hydrochloride Proadifen Blocks glibenclamide-sensitive K+ channels. Inhibits neuronal nitric oxide synthase.
56766 Spermidine, Trihydrochloride - Inhibits neuronal nitric oxide synthase.